Lineage for d5hxoa_ (5hxo A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2919043Fold c.101: Undecaprenyl diphosphate synthase [64004] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 342156
  4. 2919044Superfamily c.101.1: Undecaprenyl diphosphate synthase [64005] (2 families) (S)
    the sheet topology is similar to those of the N-terminal domain of phosphoglycerate kinase and carbamate kinase
  5. 2919112Family c.101.1.0: automated matches [191361] (1 protein)
    not a true family
  6. 2919113Protein automated matches [190431] (13 species)
    not a true protein
  7. 2919170Species Solanum habrochaites [TaxId:62890] [332525] (5 PDB entries)
  8. 2919175Domain d5hxoa_: 5hxo A: [332572]
    automated match to d4h8ea_
    mutant

Details for d5hxoa_

PDB Entry: 5hxo (more details), 2.05 Å

PDB Description: crystal structure of z,z-farnesyl diphosphate synthase with d71m, e75a and h103y mutants
PDB Compounds: (A:) (2Z,6Z)-farnesyl diphosphate synthase, chloroplastic

SCOPe Domain Sequences for d5hxoa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5hxoa_ c.101.1.0 (A:) automated matches {Solanum habrochaites [TaxId: 62890]}
mpkhialimdgnrrwakdkgldvsegykhlfpklkeicdissklgiqvitafafstenwk
rakgevdflmqmfeelydefsrsgvrvsiigcktdlpmtlqkcialteettkgnkglhlv
ialnyggyydilqatksivnkamnglldvedinknlfdqeleskcpnpdllirtggdqrv
snfllwqlaytefyftktlfpdfgeedlkeaiinfqqr

SCOPe Domain Coordinates for d5hxoa_:

Click to download the PDB-style file with coordinates for d5hxoa_.
(The format of our PDB-style files is described here.)

Timeline for d5hxoa_: