SCOPe 2.08: Domain d5jzba_: 5jzb A:

Lineage for d5jzba_ (5jzb A:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
   core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest

4. Superfamily c.69.1: alpha/beta-Hydrolases [53474] (43 families)
   many members have left-handed crossover connection between strand 8 and additional strand 9

5. Family c.69.1.0: automated matches [191404] (1 protein)
   not a true family

6. Protein automated matches [190543] (131 species)
   not a true protein

7. Species Mycobacterium tuberculosis [TaxId:83332] [189096] (13 PDB entries)

8. Domain d5jzba_: 5jzb A: [332569]
   automated match to d2vf2a_
   complexed with 6ot, po4

Details for d5jzba_

PDB Entry: 5jzb, 2.1 Å

PDB Description: crystal structure of hsad bound to 3,5-dichlorobenzene sulphonamide

PDB Compounds: (A:) 4,5:9,10-diseco-3-hydroxy-5,9,17-trioxoandrosta-1(10),2-diene-4-oate hydrolase

SCOPe Domain Sequences for d5jzba_:

Sequence; same for both SEQRES and ATOM records:

>d5jzba_ c.69.1.0 (A:) automated matches {Mycobacterium tuberculosis [TaxId: 83332]}
ltfestsrfaevdvdgplklhyheagvgndqtvvllhgggpgaaswtnfsrniavlarhf
hvlavdqpgyghsdkraehgqfnryaamalkglfdqlglgrvplvgnslgggtavrfald
yparagrlvlmgpgglsinlfapdptegvkrlskfsvaptrenleaflrvmvydknlitp
elvdqrfalastpesltatramgksfagadfeagmmwrevyrlrqpvlliwgredrvnpl
dgalvalktipraqlhvfgqcghwvqvekfdefnkltieflg

Timeline for d5jzba_:

• d5jzba_ first appeared in SCOPe 2.06
  
• d5jzba_ appears in SCOPe 2.07