| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.8: The "swivelling" beta/beta/alpha domain [52008] (10 superfamilies) 3 layers: b/b/a; the central sheet is parallel, and the other one is antiparallel; there are some variations in topology this domain is thought to be mobile in most multi-domain proteins known to contain it |
Superfamily c.8.1: Phosphohistidine domain [52009] (3 families) ![]() contains barrel, closed, n=7, S=10 |
| Family c.8.1.0: automated matches [310665] (1 protein) not a true family |
| Protein automated matches [310840] (3 species) not a true protein |
| Species Flaveria trinervia [TaxId:4227] [332554] (3 PDB entries) |
| Domain d5jvla2: 5jvl A:381-515 [332562] Other proteins in same PDB: d5jvla1, d5jvla3, d5jvlb1, d5jvlc1, d5jvlc3, d5jvld1, d5jvld3 automated match to d1vbga2 complexed with 6nq, mg, pep |
PDB Entry: 5jvl (more details), 2.9 Å
SCOPe Domain Sequences for d5jvla2:
Sequence; same for both SEQRES and ATOM records: (download)
>d5jvla2 c.8.1.0 (A:381-515) automated matches {Flaveria trinervia [TaxId: 4227]}
qfedpsaykshvvatglpaspgaavgqvcfsaedaetwhaqgksailvrtetspedvggm
haaagiltarggmtshaavvargwgkccvsgcadirvnddmkiftigdrvikegdwlsln
gttgevilgkqllap
Timeline for d5jvla2: