Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.142: ATP-grasp [56058] (2 superfamilies) Consists of two subdomains with different alpha+beta folds shares functional and structural similarities with the PIPK and protein kinase superfamilies |
Superfamily d.142.1: Glutathione synthetase ATP-binding domain-like [56059] (11 families) |
Family d.142.1.0: automated matches [227184] (1 protein) not a true family |
Protein automated matches [226904] (38 species) not a true protein |
Species Flaveria trinervia [TaxId:4227] [332552] (3 PDB entries) |
Domain d5jvla1: 5jvl A:1-380 [332561] Other proteins in same PDB: d5jvla2, d5jvla3, d5jvlb1, d5jvlb3, d5jvlc2, d5jvlc3, d5jvld2, d5jvld3 automated match to d1vbga3 complexed with 6nq, mg, pep |
PDB Entry: 5jvl (more details), 2.9 Å
SCOPe Domain Sequences for d5jvla1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5jvla1 d.142.1.0 (A:1-380) automated matches {Flaveria trinervia [TaxId: 4227]} kkrvftfgkgrsegnrdmksllggkganlaemssiglsvppgltisteaceeyqqngksl ppglwdeisegldyvqkemsaslgdpskplllsvrsgaaismpgmmdtvlnlglndevva glagksgarfaydsyrrfldmfgnvvmgiphslfdekleqmkaekgihldtdltaadlkd lvekyknvyveakgekfptdpkkqlelavnavfdswdsprankyrsinqitglkgtavni qsmvfgnmgntsgtgvlftrnpstgekklygeflinaqgedvvagirtpedlgtmetcmp eaykelvenceilerhykdmmdieftvqenrlwmlqcrtgkrtgkgavriavdmvnegli dtrtaikrvetqhldqllhp
Timeline for d5jvla1: