Lineage for d5jjcc_ (5jjc C:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2907391Fold c.79: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53685] (1 superfamily)
    consists of two similar domains related by pseudo dyad; duplication
    core: 3 layers, a/b/a; parallel beta-sheet of 4 strands, order 3214
  4. 2907392Superfamily c.79.1: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53686] (2 families) (S)
  5. 2907817Family c.79.1.0: automated matches [191338] (1 protein)
    not a true family
  6. 2907818Protein automated matches [190215] (38 species)
    not a true protein
  7. 2907842Species Brucella abortus [TaxId:430066] [332547] (2 PDB entries)
  8. 2907845Domain d5jjcc_: 5jjc C: [332558]
    automated match to d4airb_
    mutant

Details for d5jjcc_

PDB Entry: 5jjc (more details), 2.01 Å

PDB Description: crystal structure of double mutant (q96a-y125a) o-acetyl serine sulfhydralase from brucella abortus
PDB Compounds: (C:) Cysteine synthase

SCOPe Domain Sequences for d5jjcc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5jjcc_ c.79.1.0 (C:) automated matches {Brucella abortus [TaxId: 430066]}
mfnsvldtigntplirlskaseltgcdiygkaeflnpgqsvkdraalyiirdaekrgllr
pggvivegtagntgigltmvakalgyrtaivipetasqekkdalrllgaelievpaapyr
npnnavrlsgrlaeqlaktepngaiwanqfdntvnrqahiettaqeiwrdtsdqidgfva
avgsggtlagtaiglkernhnikialadphgaalhafyttgelkaegdsitegigqgrit
anlegftpdfsyqipdaealdilfalveeeglclggssginiagairlakdlgpghtivt
vlcdygnryqsklfnpaflrgkslpvprwle

SCOPe Domain Coordinates for d5jjcc_:

Click to download the PDB-style file with coordinates for d5jjcc_.
(The format of our PDB-style files is described here.)

Timeline for d5jjcc_: