SCOPe 2.08: Domain d5jvjb2: 5jvj B:381-515

Lineage for d5jvjb2 (5jvj B:381-515)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.8: The 'swivelling' beta/beta/alpha domain [52008] (10 superfamilies)
   3 layers: b/b/a; the central sheet is parallel, and the other one is antiparallel; there are some variations in topology
   this domain is thought to be mobile in most multi-domain proteins known to contain it

4. Superfamily c.8.1: Phosphohistidine domain [52009] (3 families)
   contains barrel, closed, n=7, S=10

5. Family c.8.1.0: automated matches [310665] (1 protein)
   not a true family

6. Protein automated matches [310840] (3 species)
   not a true protein

7. Species Flaveria trinervia [TaxId:4227] [332554] (3 PDB entries)

8. Domain d5jvjb2: 5jvj B:381-515 [332555]
   Other proteins in same PDB: d5jvja1, d5jvja3, d5jvjb1, d5jvjb3
   automated match to d1vbga2
   complexed with mg, pep

Details for d5jvjb2

PDB Entry: 5jvj, 2.9 Å

PDB Description: c4-type pyruvate phosphate dikinase: different conformational states of the nucleotide binding domain in the dimer

PDB Compounds: (B:) Pyruvate, phosphate dikinase, chloroplastic

SCOPe Domain Sequences for d5jvjb2:

Sequence; same for both SEQRES and ATOM records:

>d5jvjb2 c.8.1.0 (B:381-515) automated matches {Flaveria trinervia [TaxId: 4227]}
qfedpsaykshvvatglpaspgaavgqvcfsaedaetwhaqgksailvrtetspedvggm
haaagiltarggmtshaavvargwgkccvsgcadirvnddmkiftigdrvikegdwlsln
gttgevilgkqllap

Timeline for d5jvjb2:

• d5jvjb2 first appeared in SCOPe 2.06
  
• d5jvjb2 appears in SCOPe 2.07