![]() | Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
![]() | Fold d.142: ATP-grasp [56058] (2 superfamilies) Consists of two subdomains with different alpha+beta folds shares functional and structural similarities with the PIPK and protein kinase superfamilies |
![]() | Superfamily d.142.1: Glutathione synthetase ATP-binding domain-like [56059] (11 families) ![]() |
![]() | Family d.142.1.0: automated matches [227184] (1 protein) not a true family |
![]() | Protein automated matches [226904] (38 species) not a true protein |
![]() | Species Flaveria trinervia [TaxId:4227] [332552] (3 PDB entries) |
![]() | Domain d5jvjb1: 5jvj B:2-380 [332553] Other proteins in same PDB: d5jvja2, d5jvja3, d5jvjb2, d5jvjb3 automated match to d1vbga3 complexed with mg, pep |
PDB Entry: 5jvj (more details), 2.9 Å
SCOPe Domain Sequences for d5jvjb1:
Sequence, based on SEQRES records: (download)
>d5jvjb1 d.142.1.0 (B:2-380) automated matches {Flaveria trinervia [TaxId: 4227]} krvftfgkgrsegnrdmksllggkganlaemssiglsvppgltisteaceeyqqngkslp pglwdeisegldyvqkemsaslgdpskplllsvrsgaaismpgmmdtvlnlglndevvag lagksgarfaydsyrrfldmfgnvvmgiphslfdekleqmkaekgihldtdltaadlkdl vekyknvyveakgekfptdpkkqlelavnavfdswdsprankyrsinqitglkgtavniq smvfgnmgntsgtgvlftrnpstgekklygeflinaqgedvvagirtpedlgtmetcmpe aykelvenceilerhykdmmdieftvqenrlwmlqcrtgkrtgkgavriavdmvneglid trtaikrvetqhldqllhp
>d5jvjb1 d.142.1.0 (B:2-380) automated matches {Flaveria trinervia [TaxId: 4227]} krvftfgkgrsegnrdggkganlaemssiglsvppgltisdeisegldyvqkemsaskpl llsvrsgaaidtvlnlglndevvksgarfaydsyrrfldmfgnvvmgiphslfdekleqm kihldtdltaadlkdlvekyknvyvetdpkkqlelavnavfdsavniqsmvfgnmgntsg tgvlftrnpstgekklygeflinaqgedvvagirtpedlgtmetcmpeaykelvenceil erhykdmmdieftvqenrlwmlqcrtgkrtgkgavriavdmvneglidtrtaikrvetqh ldqllhp
Timeline for d5jvjb1: