Lineage for d5gv7a1 (5gv7 A:1001-1125)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2062589Fold b.43: Reductase/isomerase/elongation factor common domain [50412] (4 superfamilies)
    barrel, closed; n=6, S=10; greek-key
  4. 2063096Superfamily b.43.4: Riboflavin synthase domain-like [63380] (4 families) (S)
  5. 2063153Family b.43.4.2: Ferredoxin reductase FAD-binding domain-like [63381] (10 proteins)
    coupled with a NADP-binding domain of alpha/beta class
  6. 2063158Protein cytochrome b5 reductase [50427] (3 species)
  7. 2063166Species Pig (Sus scrofa), liver [TaxId:9823] [50428] (9 PDB entries)
  8. 2063169Domain d5gv7a1: 5gv7 A:1001-1125 [332545]
    Other proteins in same PDB: d5gv7a2
    automated match to d1ndha1
    complexed with fad, gol

Details for d5gv7a1

PDB Entry: 5gv7 (more details), 0.8 Å

PDB Description: structure of nadh-cytochrome b5 reductase refined with the multipolar atomic model at 0.80 a
PDB Compounds: (A:) NADH-cytochrome b5 reductase 3

SCOPe Domain Sequences for d5gv7a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5gv7a1 b.43.4.2 (A:1001-1125) cytochrome b5 reductase {Pig (Sus scrofa), liver [TaxId: 9823]}
stpaitlenpdikyplrlidkevvnhdtrrfrfalpspehilglpvgqhiylsaridgnl
virpytpvssdddkgfvdlvikvyfkdthpkfpaggkmsqylesmkigdtiefrgpngll
vyqgk

SCOPe Domain Coordinates for d5gv7a1:

Click to download the PDB-style file with coordinates for d5gv7a1.
(The format of our PDB-style files is described here.)

Timeline for d5gv7a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d5gv7a2