Lineage for d5iu6b_ (5iu6 B:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2495627Fold c.56: Phosphorylase/hydrolase-like [53162] (8 superfamilies)
    core: 3 layers, a/b/a ; mixed sheet of 5 strands: order 21354; strand 4 is antiparallel to the rest; contains crossover loops
  4. 2495644Superfamily c.56.2: Purine and uridine phosphorylases [53167] (2 families) (S)
    complex architecture; contains mixed beta-sheet of 8 strands, order 23415867, strands 3, 6 & 7 are antiparallel to the rest; and barrel, closed; n=5, S=8
  5. 2495645Family c.56.2.1: Purine and uridine phosphorylases [53168] (7 proteins)
  6. 2495769Protein Purine nucleoside phosphorylase, PNP [53169] (14 species)
  7. 2495830Species Escherichia coli [TaxId:562] [53172] (28 PDB entries)
  8. 2495952Domain d5iu6b_: 5iu6 B: [332539]
    automated match to d1k9sa_
    complexed with 7hx, so4

Details for d5iu6b_

PDB Entry: 5iu6 (more details), 2.51 Å

PDB Description: crystal structure of e.coli purine nucleoside phosphorylase with 7- deazahypoxanthine
PDB Compounds: (B:) Purine nucleoside phosphorylase deoD-type

SCOPe Domain Sequences for d5iu6b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5iu6b_ c.56.2.1 (B:) Purine nucleoside phosphorylase, PNP {Escherichia coli [TaxId: 562]}
atphinaemgdfadvvlmpgdplrakyiaetfledarevnnvrgmlgftgtykgrkisvm
ghgmgipscsiytkelitdfgvkkiirvgscgavlphvklrdvvigmgactdskvnrirf
kdhdfaaiadfdmvrnavdaakalgidarvgnlfsadlfyspdgemfdvmekygilgvem
eaagiygvaaefgakaltictvsdhirtheqttaaerqttfndmikialesvllgdk

SCOPe Domain Coordinates for d5iu6b_:

Click to download the PDB-style file with coordinates for d5iu6b_.
(The format of our PDB-style files is described here.)

Timeline for d5iu6b_: