Lineage for d1b97b_ (1b97 B:)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2136225Fold c.52: Restriction endonuclease-like [52979] (4 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 5 strands, order 12345; strands 2 &, in some families, 5 are antiparallel to the rest
  4. 2136226Superfamily c.52.1: Restriction endonuclease-like [52980] (36 families) (S)
  5. 2136242Family c.52.1.2: Restriction endonuclease EcoRV [52984] (1 protein)
    automatically mapped to Pfam PF09233
  6. 2136243Protein Restriction endonuclease EcoRV [52985] (1 species)
  7. 2136244Species Escherichia coli [TaxId:562] [52986] (30 PDB entries)
  8. 2136268Domain d1b97b_: 1b97 B: [33253]
    protein/DNA complex; mutant

Details for d1b97b_

PDB Entry: 1b97 (more details), 1.9 Å

PDB Description: analysis of a mutational hot-spot in the ecorv restriction endonuclease: a catalytic role for a main chain carbonyl group
PDB Compounds: (B:) restriction endonuclease ecorv

SCOPe Domain Sequences for d1b97b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1b97b_ c.52.1.2 (B:) Restriction endonuclease EcoRV {Escherichia coli [TaxId: 562]}
slrsdlinalydenqkydvcgiisaegkiyplgsdtkvlstifelfsrpiinkiaekhgy
iveepkqlnhypdftlykpsepnkkiaidikttytnkenekikftlggytsfirnntkni
vypfdqyiahwiigyvytrvatrksslktyninelneipkpykgvkvflqdkwviagdla
gsgnttnigsihahykdfvegkgifdsedefldywrnyertsqlrndkynniseyrnwiy
rgrk

SCOPe Domain Coordinates for d1b97b_:

Click to download the PDB-style file with coordinates for d1b97b_.
(The format of our PDB-style files is described here.)

Timeline for d1b97b_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1b97a_