Lineage for d1b94b_ (1b94 B:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2882263Fold c.52: Restriction endonuclease-like [52979] (4 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 5 strands, order 12345; strands 2 &, in some families, 5 are antiparallel to the rest
  4. 2882264Superfamily c.52.1: Restriction endonuclease-like [52980] (37 families) (S)
  5. 2882280Family c.52.1.2: Restriction endonuclease EcoRV [52984] (1 protein)
    automatically mapped to Pfam PF09233
  6. 2882281Protein Restriction endonuclease EcoRV [52985] (1 species)
  7. 2882282Species Escherichia coli [TaxId:562] [52986] (30 PDB entries)
  8. 2882312Domain d1b94b_: 1b94 B: [33251]
    protein/DNA complex; complexed with ca

Details for d1b94b_

PDB Entry: 1b94 (more details), 1.9 Å

PDB Description: restriction endonuclease ecorv with calcium
PDB Compounds: (B:) restriction endonuclease ecorv

SCOPe Domain Sequences for d1b94b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1b94b_ c.52.1.2 (B:) Restriction endonuclease EcoRV {Escherichia coli [TaxId: 562]}
slrsdlinalydenqkydvcgiisaegkiyplgsdtkvlstifelfsrpiinkiaekhgy
iveepkqqnhypdftlykpsepnkkiaidikttytnkenekikftlggytsfirnntkni
vypfdqyiahwiigyvytrvatrksslktyninelneipkpykgvkvflqdkwviagdla
gsgnttnigsihahykdfvegkgifdsedefldywrnyertsqlrndkynniseyrnwiy
rgrk

SCOPe Domain Coordinates for d1b94b_:

Click to download the PDB-style file with coordinates for d1b94b_.
(The format of our PDB-style files is described here.)

Timeline for d1b94b_: