SCOPe 2.08: Domain d5jnua_: 5jnu A:

Lineage for d5jnua_ (5jnu A:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.44: Phosphotyrosine protein phosphatases I-like [52787] (3 superfamilies)
   3 layers: a/b/a; parallel beta-sheet of 4 strands, order 2134

4. Superfamily c.44.1: Phosphotyrosine protein phosphatases I [52788] (2 families)
   share the common active site structure with the family II

5. Family c.44.1.1: Low-molecular-weight phosphotyrosine protein phosphatases [52789] (3 proteins)
   automatically mapped to Pfam PF01451

6. Protein Tyrosine phosphatase [52790] (5 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [187979] (2 PDB entries)

8. Domain d5jnua_: 5jnu A: [332490]
   automated match to d5pnta_
   complexed with po4

Details for d5jnua_

PDB Entry: 5jnu, 2.54 Å

PDB Description: crystal structure of mouse low-molecular weight protein tyrosine phosphatase type a (lmptp-a) complexed with phosphate

PDB Compounds: (A:) Low molecular weight phosphotyrosine protein phosphatase

SCOPe Domain Sequences for d5jnua_:

Sequence; same for both SEQRES and ATOM records:

>d5jnua_ c.44.1.1 (A:) Tyrosine phosphatase {Mouse (Mus musculus) [TaxId: 10090]}
gsksvlfvclgnicrspiaeavfrklvtdekvsdnwridsaatstyevgnppdyrgqncm
rkhgihmqhiarqitkedfatfdyilcmdesnlrdlnrksnqvknckakiellgsydpqk
qliiedpyygndsdfevvyqqclrcckaflekt

Timeline for d5jnua_:

• d5jnua_ first appeared in SCOPe 2.06
  
• d5jnua_ appears in SCOPe 2.07