![]() | Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
![]() | Fold d.157: Metallo-hydrolase/oxidoreductase [56280] (1 superfamily) duplication of beta(4)-alpha-beta-alpha motif; 4 layers a/b/b/a; mixed beta-sheets |
![]() | Superfamily d.157.1: Metallo-hydrolase/oxidoreductase [56281] (15 families) ![]() |
![]() | Family d.157.1.0: automated matches [191360] (1 protein) not a true family |
![]() | Protein automated matches [190418] (31 species) not a true protein |
![]() | Species Acinetobacter baumannii [TaxId:470] [332487] (1 PDB entry) |
![]() | Domain d5mmde_: 5mmd E: [332488] automated match to d1jjeb_ complexed with cl, zn |
PDB Entry: 5mmd (more details), 1.75 Å
SCOPe Domain Sequences for d5mmde_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5mmde_ d.157.1.0 (E:) automated matches {Acinetobacter baumannii [TaxId: 470]} eipgleveeidngvflhksysrvegwglvssnglvvisggkafiidtpwsesdteklvdw irskkyelagsisthshedktagikwlngksittyasaltneilkregkeqarssfkgne fslmdgflevyypggghtidnlvvwipsskilyggcfirslessglgytgeakidqwpqs arntiskypeakivvpghgkigdfellkhtkvlaekasnka
Timeline for d5mmde_: