Lineage for d5iwyb_ (5iwy B:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2958618Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies)
    core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest
  4. 2960358Superfamily d.79.5: IpsF-like [69765] (2 families) (S)
    forms trimers with three closely packed beta-sheets; possible link between the YjgF-like (d.79.1) and 4'-phosphopantetheinyl transferase superfamilies (d.150.1)
  5. 2960359Family d.79.5.1: IpsF-like [69766] (3 proteins)
    automatically mapped to Pfam PF02542
  6. 2960457Protein automated matches [190985] (6 species)
    not a true protein
  7. 2960458Species Bacillus subtilis [TaxId:224308] [332335] (2 PDB entries)
  8. 2960460Domain d5iwyb_: 5iwy B: [332484]
    automated match to d1t0aa_
    complexed with c5p, mg

Details for d5iwyb_

PDB Entry: 5iwy (more details), 1.99 Å

PDB Description: crystal structure of 2-c-methyl-d-erythritol 2,4-cyclodiphosphate synthase from bacillus subtitis complexed with cmp and mg2+
PDB Compounds: (B:) 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase

SCOPe Domain Sequences for d5iwyb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5iwyb_ d.79.5.1 (B:) automated matches {Bacillus subtilis [TaxId: 224308]}
mfrigqgfdvhqlvegrpliiggieipyekgllghsdadvllhtvadaclgavgegdigk
hfpdtdpefkdadsfkllqhvwgivkqkgyvlgnidctiiaqkpkmlpyiedmrkriaeg
leadvsqvnvkattteklgftgraegiaaqatvliqkg

SCOPe Domain Coordinates for d5iwyb_:

Click to download the PDB-style file with coordinates for d5iwyb_.
(The format of our PDB-style files is described here.)

Timeline for d5iwyb_: