Lineage for d1rvbb_ (1rvb B:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2490159Fold c.52: Restriction endonuclease-like [52979] (4 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 5 strands, order 12345; strands 2 &, in some families, 5 are antiparallel to the rest
  4. 2490160Superfamily c.52.1: Restriction endonuclease-like [52980] (37 families) (S)
  5. 2490176Family c.52.1.2: Restriction endonuclease EcoRV [52984] (1 protein)
    automatically mapped to Pfam PF09233
  6. 2490177Protein Restriction endonuclease EcoRV [52985] (1 species)
  7. 2490178Species Escherichia coli [TaxId:562] [52986] (30 PDB entries)
  8. 2490188Domain d1rvbb_: 1rvb B: [33245]
    protein/DNA complex; complexed with mg

Details for d1rvbb_

PDB Entry: 1rvb (more details), 2.1 Å

PDB Description: mg2+ binding to the active site of eco rv endonuclease: a crystallographic study of complexes with substrate and product dna at 2 angstroms resolution
PDB Compounds: (B:) protein (eco rv (e.c.3.1.21.4))

SCOPe Domain Sequences for d1rvbb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1rvbb_ c.52.1.2 (B:) Restriction endonuclease EcoRV {Escherichia coli [TaxId: 562]}
slrsdlinalydenqkydvcgiisaegkiyplgsdtkvlstifelfsrpiinkiaekhgy
iveepkqqnhypdftlykpsepnkkiaidikttytnkenekikftlggytsfirnntkni
vypfdqyiahwiigyvytrvatrksslktyninelneipkpykgvkvflqdkwviagdla
gsgnttnigsihahykdfvegkgifdsedefldywrnyertsqlrndkynniseyrnwiy
rgrk

SCOPe Domain Coordinates for d1rvbb_:

Click to download the PDB-style file with coordinates for d1rvbb_.
(The format of our PDB-style files is described here.)

Timeline for d1rvbb_: