SCOPe 2.07: Domain d5nevd2: 5nev D:310-429

Lineage for d5nevd2 (5nev D:310-429)

Root: SCOPe 2.07
Class a: All alpha proteins [46456] (289 folds)
Fold a.74: Cyclin-like [47953] (1 superfamily)
core: 5 helices; one helix is surrounded by the others
Superfamily a.74.1: Cyclin-like [47954] (4 families)
duplication: consists of two domains of this fold
Family a.74.1.1: Cyclin [47955] (9 proteins)
Protein Cyclin A [47956] (2 species)
Species Human (Homo sapiens) [TaxId:9606] [47957] (86 PDB entries)
Uniprot P20248 175-432
Domain d5nevd2: 5nev D:310-429 [332447]
Other proteins in same PDB: d5neva1, d5neva2, d5nevc1, d5nevc2
automated match to d1oi9b2
complexed with 72l

Details for d5nevd2

PDB Entry: 5nev (more details), 2.97 Å

PDB Description: cdk2/cyclin a in complex with compound 73

PDB Compounds: (D:) Cyclin-A2

SCOPe Domain Sequences for d5nevd2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5nevd2 a.74.1.1 (D:310-429) Cyclin A {Human (Homo sapiens) [TaxId: 9606]}
tvnqfltqyflhqqpanckveslamflgelslidadpylkylpsviagaafhlalytvtg
qswpeslirktgytleslkpclmdlhqtylkapqhaqqsirekyknskyhgvsllnppet

SCOPe Domain Coordinates for d5nevd2:

Click to download the PDB-style file with coordinates for d5nevd2.
(The format of our PDB-style files is described here.)

Timeline for d5nevd2: