Lineage for d2nc9a_ (2nc9 A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2725421Fold a.118: alpha-alpha superhelix [48370] (28 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 2726649Superfamily a.118.8: TPR-like [48452] (11 families) (S)
  5. 2726650Family a.118.8.1: Tetratricopeptide repeat (TPR) [48453] (21 proteins)
    this is a repeat family; one repeat unit is 1zb1 A:166-231 found in domain
  6. 2726672Protein Hop [48456] (1 species)
  7. 2726673Species Human (Homo sapiens) [TaxId:9606] [48457] (4 PDB entries)
  8. 2726678Domain d2nc9a_: 2nc9 A: [332442]
    automated match to d1elra_

Details for d2nc9a_

PDB Entry: 2nc9 (more details)

PDB Description: apo solution structure of hop tpr2a
PDB Compounds: (A:) Stress-induced-phosphoprotein 1

SCOPe Domain Sequences for d2nc9a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2nc9a_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]}
enkkqalkekelgndaykkkdfdtalkhydkakeldptnmtyitnqaavyfekgdynkcr
elcekaievgrenredyrqiakayarignsyfkeekykdaihfynkslaehrtpdvlkkc
qqaekilkeqe

SCOPe Domain Coordinates for d2nc9a_:

Click to download the PDB-style file with coordinates for d2nc9a_.
(The format of our PDB-style files is described here.)

Timeline for d2nc9a_: