Lineage for d1rvba_ (1rvb A:)

  1. Root: SCOP 1.57
  2. 64291Class c: Alpha and beta proteins (a/b) [51349] (107 folds)
  3. 71527Fold c.52: Restriction endonuclease-like [52979] (3 superfamilies)
  4. 71528Superfamily c.52.1: Restriction endonuclease-like [52980] (18 families) (S)
  5. 71541Family c.52.1.2: Restriction endonuclease EcoRV [52984] (1 protein)
  6. 71542Protein Restriction endonuclease EcoRV [52985] (1 species)
  7. 71543Species Escherichia coli [TaxId:562] [52986] (23 PDB entries)
  8. 71554Domain d1rvba_: 1rvb A: [33244]

Details for d1rvba_

PDB Entry: 1rvb (more details), 2.1 Å

PDB Description: mg2+ binding to the active site of eco rv endonuclease: a crystallographic study of complexes with substrate and product dna at 2 angstroms resolution

SCOP Domain Sequences for d1rvba_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1rvba_ c.52.1.2 (A:) Restriction endonuclease EcoRV {Escherichia coli}
slrsdlinalydenqkydvcgiisaegkiyplgsdtkvlstifelfsrpiinkiaekhgy
iveepkqqnhypdftlykpsepnkkiaidikttytnkenekikftlggytsfirnntkni
vypfdqyiahwiigyvytrvatrksslktyninelneipkpykgvkvflqdkwviagdla
gsgnttnigsihahykdfvegkgifdsedefldywrnyertsqlrndkynniseyrnwiy
rgrk

SCOP Domain Coordinates for d1rvba_:

Click to download the PDB-style file with coordinates for d1rvba_.
(The format of our PDB-style files is described here.)

Timeline for d1rvba_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1rvbb_