SCOPe 2.08: Domain d5k39a1: 5k39 A:4-163

Lineage for d5k39a1 (5k39 A:4-163)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (9 superfamilies)
   sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold

4. Superfamily b.2.2: Carbohydrate-binding domain [49384] (4 families)

5. Family b.2.2.0: automated matches [191610] (1 protein)
   not a true family

6. Protein automated matches [191113] (13 species)
   not a true protein

7. Species Ruminiclostridium thermocellum [TaxId:1249482] [332429] (1 PDB entry)

8. Domain d5k39a1: 5k39 A:4-163 [332430]
   Other proteins in same PDB: d5k39a2, d5k39a3, d5k39b1, d5k39b2
   automated match to d4fl4b_
   complexed with ca

Details for d5k39a1

PDB Entry: 5k39, 1.98 Å

PDB Description: the type ii cohesin dockerin complex from clostridium thermocellum

PDB Compounds: (A:) Cellulosome anchoring protein cohesin region

SCOPe Domain Sequences for d5k39a1:

Sequence; same for both SEQRES and ATOM records:

>d5k39a1 b.2.2.0 (A:4-163) automated matches {Ruminiclostridium thermocellum [TaxId: 1249482]}
ahialeldktkvkvgdvivatvkaknmtsmagiqvnikydpevlqaidpatgkpftketl
lvdpellsnreynplltavndinsgiinyascyvywdsyresgvsestgiigkvgfkvlk
aanttvkleetrftpnsidgtlvidwygqqivgykviqpd

Timeline for d5k39a1:

• d5k39a1 first appeared in SCOPe 2.06
  
• d5k39a1 appears in SCOPe 2.07