![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily) core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest |
![]() | Superfamily c.69.1: alpha/beta-Hydrolases [53474] (43 families) ![]() many members have left-handed crossover connection between strand 8 and additional strand 9 |
![]() | Family c.69.1.3: Mycobacterial antigens [53491] (5 proteins) automatically mapped to Pfam PF00756 |
![]() | Protein automated matches [227016] (2 species) not a true protein |
![]() | Species Mycobacterium tuberculosis [TaxId:1773] [225761] (6 PDB entries) |
![]() | Domain d5kwjb_: 5kwj B: [332419] automated match to d1sfra_ complexed with 6y3 |
PDB Entry: 5kwj (more details), 2.01 Å
SCOPe Domain Sequences for d5kwjb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5kwjb_ c.69.1.3 (B:) automated matches {Mycobacterium tuberculosis [TaxId: 1773]} mfsrpglpveylqvpsasmgrdikvqfqgggphavylldglraqddyngwdintpafeey yqsglsvimpvggqssfytdwyqpsqsngqnytykwetfltrempawlqankgvsptgna avglsmsggsalilaayypqqfpyaaslsgflnpsegwwptliglamndsggynansmwg pssdpawkrndpmvqiprlvanntriwvycgngtpsdlggdnipakflegltlrtnqtfr dtyaadggrngvfnfppngthswpywneqlvamkadiqhvlng
Timeline for d5kwjb_: