Lineage for d1rvab_ (1rva B:)

  1. Root: SCOP 1.55
  2. 18352Class c: Alpha and beta proteins (a/b) [51349] (97 folds)
  3. 24772Fold c.52: Restriction endonuclease-like [52979] (3 superfamilies)
  4. 24773Superfamily c.52.1: Restriction endonuclease-like [52980] (17 families) (S)
  5. 24786Family c.52.1.2: Restriction endonuclease EcoRV [52984] (1 protein)
  6. 24787Protein Restriction endonuclease EcoRV [52985] (1 species)
  7. 24788Species Escherichia coli [TaxId:562] [52986] (23 PDB entries)
  8. 24792Domain d1rvab_: 1rva B: [33241]

Details for d1rvab_

PDB Entry: 1rva (more details), 2 Å

PDB Description: mg2+ binding to the active site of eco rv endonuclease: a crystallographic study of complexes with substrate and product dna at 2 angstroms resolution

SCOP Domain Sequences for d1rvab_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1rvab_ c.52.1.2 (B:) Restriction endonuclease EcoRV {Escherichia coli}
slrsdlinalydenqkydvcgiisaegkiyplgsdtkvlstifelfsrpiinkiaekhgy
iveepkqqnhypdftlykpsepnkkiaidikttytnkenekikftlggytsfirnntkni
vypfdqyiahwiigyvytrvatrksslktyninelneipkpykgvkvflqdkwviagdla
gsgnttnigsihahykdfvegkgifdsedefldywrnyertsqlrndkynniseyrnwiy
rgrk

SCOP Domain Coordinates for d1rvab_:

Click to download the PDB-style file with coordinates for d1rvab_.
(The format of our PDB-style files is described here.)

Timeline for d1rvab_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1rvaa_