SCOPe 2.06: Domain d5iw1d1: 5iw1 D:3-111

Lineage for d5iw1d1 (5iw1 D:3-111)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (28 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187920] (935 PDB entries)

8. Domain d5iw1d1: 5iw1 D:3-111 [332407]
   Other proteins in same PDB: d5iw1c1
   automated match to d3mffb1

Details for d5iw1d1

PDB Entry: 5iw1, 3 Å

PDB Description: crystal structure of b4.2.3 t-cell receptor

PDB Compounds: (D:) T-cell receptor beta chain

SCOPe Domain Sequences for d5iw1d1:

Sequence; same for both SEQRES and ATOM records:

>d5iw1d1 b.1.1.0 (D:3-111) automated matches {Human (Homo sapiens) [TaxId: 9606]}
vtqmprylikrmgenvllecgqdmshetmywyrqdpglglqliyisydvdsnsegdipkg
yrvsrkkrehfslildsaktnqtsvyfcasslghtevffgkgtrltvve

Timeline for d5iw1d1:

• d5iw1d1 is new in SCOPe 2.06-stable
  
• d5iw1d1 appears in SCOPe 2.07
  
• d5iw1d1 appears in the current release, SCOPe 2.08