SCOPe 2.08: Domain d5ipaa2: 5ipa A:95-214

Lineage for d5ipaa2 (5ipa A:95-214)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.121: Tetracyclin repressor-like, C-terminal domain [48497] (1 superfamily)
   multihelical; interlocked (homo)dimer

4. Superfamily a.121.1: Tetracyclin repressor-like, C-terminal domain [48498] (2 families)

5. Family a.121.1.1: Tetracyclin repressor-like, C-terminal domain [48499] (35 proteins)

6. Protein Ethr repressor [109978] (2 species)

7. Species Mycobacterium tuberculosis [TaxId:419947] [332341] (4 PDB entries)

8. Domain d5ipaa2: 5ipa A:95-214 [332404]
   Other proteins in same PDB: d5ipaa1
   automated match to d1t56a2
   complexed with 6c8

Details for d5ipaa2

PDB Entry: 5ipa, 1.78 Å

PDB Description: structure of transcriptional regulatory repressor protein - ethr from mycobacterium tuberculosis in complex with (e)-3-(furan-3-yl)-1- (pyrrolidin-1-yl)prop-2-en-1-one at 1.78a resolution

PDB Compounds: (A:) TetR-family transcriptional regulatory repressor protein

SCOPe Domain Sequences for d5ipaa2:

Sequence; same for both SEQRES and ATOM records:

>d5ipaa2 a.121.1.1 (A:95-214) Ethr repressor {Mycobacterium tuberculosis [TaxId: 419947]}
adtdrenmwrtginvffetfgshkavtragqaaratsvevaelwstfmqkwiaytaavid
aerdrgaaprtlpahelatalnlmnertlfasfageqpsvpearvldtlvhiwvtsiyge

Timeline for d5ipaa2:

• d5ipaa2 first appeared in SCOPe 2.06
  
• d5ipaa2 appears in SCOPe 2.07