Lineage for d5ihia_ (5ihi A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2782725Fold b.34: SH3-like barrel [50036] (21 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 2782861Superfamily b.34.2: SH3-domain [50044] (2 families) (S)
  5. 2782862Family b.34.2.1: SH3-domain [50045] (40 proteins)
  6. 2782886Protein alpha-Spectrin, SH3 domain [50058] (1 species)
  7. 2782887Species Chicken (Gallus gallus) [TaxId:9031] [50059] (38 PDB entries)
  8. 2782893Domain d5ihia_: 5ihi A: [332402]
    automated match to d2f2va_
    complexed with peg, so4; mutant

Details for d5ihia_

PDB Entry: 5ihi (more details), 1.45 Å

PDB Description: crystal structure of the alpha spectrin sh3 domain double mutant v46g- d48g
PDB Compounds: (A:) spectrin alpha chain, non-erythrocytic 1

SCOPe Domain Sequences for d5ihia_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5ihia_ b.34.2.1 (A:) alpha-Spectrin, SH3 domain {Chicken (Gallus gallus) [TaxId: 9031]}
elvlalydyqeksprevtmkkgdiltllnstnkdwwkvegngrqgfvpaayvkkl

SCOPe Domain Coordinates for d5ihia_:

Click to download the PDB-style file with coordinates for d5ihia_.
(The format of our PDB-style files is described here.)

Timeline for d5ihia_: