Lineage for d5jnwa_ (5jnw A:)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2130626Fold c.44: Phosphotyrosine protein phosphatases I-like [52787] (3 superfamilies)
    3 layers: a/b/a; parallel beta-sheet of 4 strands, order 2134
  4. 2130627Superfamily c.44.1: Phosphotyrosine protein phosphatases I [52788] (2 families) (S)
    share the common active site structure with the family II
  5. 2130628Family c.44.1.1: Low-molecular-weight phosphotyrosine protein phosphatases [52789] (3 proteins)
    automatically mapped to Pfam PF01451
  6. 2130652Protein Tyrosine phosphatase [52790] (5 species)
  7. 2130660Species Cow (Bos taurus) [TaxId:9913] [52791] (9 PDB entries)
  8. 2130669Domain d5jnwa_: 5jnw A: [332399]
    automated match to d1dg9a_
    complexed with 6lj, vo4; mutant

Details for d5jnwa_

PDB Entry: 5jnw (more details), 1.86 Å

PDB Description: crystal structure of bovine low molecular weight protein tyrosine phosphatase (lmptp) mutant (w49y n50e) complexed with vanadate and uncompetitive inhibitor
PDB Compounds: (A:) Low molecular weight phosphotyrosine protein phosphatase

SCOPe Domain Sequences for d5jnwa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5jnwa_ c.44.1.1 (A:) Tyrosine phosphatase {Cow (Bos taurus) [TaxId: 9913]}
vtksvlfvclgnicrspiaeavfrklvtdqnisdnwvidsgavsdyevgrspdpravscl
rnhgintahkarqvtkedfvtfdyilcmdesnlrdlnrksnqvkncrakiellgsydpqk
qliiedpyygndadfetvyqqcvrccraflekvr

SCOPe Domain Coordinates for d5jnwa_:

Click to download the PDB-style file with coordinates for d5jnwa_.
(The format of our PDB-style files is described here.)

Timeline for d5jnwa_: