Lineage for d5ivua_ (5ivu A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2969655Fold d.109: Gelsolin-like [55752] (3 superfamilies)
    3 layers: a/b/a; contains mixed beta-sheet
  4. 2969656Superfamily d.109.1: Actin depolymerizing proteins [55753] (3 families) (S)
  5. 2969935Family d.109.1.0: automated matches [191561] (1 protein)
    not a true family
  6. 2969936Protein automated matches [190971] (14 species)
    not a true protein
  7. 2970012Species Streptomyces griseoflavus [TaxId:35619] [332372] (1 PDB entry)
  8. 2970013Domain d5ivua_: 5ivu A: [332393]
    automated match to d1tvja_

Details for d5ivua_

PDB Entry: 5ivu (more details), 2.42 Å

PDB Description: crystal structure of streptomyces griseoflavus cofilin
PDB Compounds: (A:) cofilin

SCOPe Domain Sequences for d5ivua_:

Sequence, based on SEQRES records: (download)

>d5ivua_ d.109.1.0 (A:) automated matches {Streptomyces griseoflavus [TaxId: 35619]}
gvtlndacvetyqqlklgkklkyiifhlnkenteiavekssdsvdydnfladlpedecrw
avydleyekeegagkrnkltfvswapdsakmkqkmayasskdilrraltgiaveiqgtdf
sevahenvldkas

Sequence, based on observed residues (ATOM records): (download)

>d5ivua_ d.109.1.0 (A:) automated matches {Streptomyces griseoflavus [TaxId: 35619]}
gvtlndacvetyqqlklgkklkyiifhlnnteiavekssdsvdydnfladlpedecrwav
ydleyegkrnkltfvswapdsakmkqkmayasskdilrraltgiaveiqgtdfsevahen
vldkas

SCOPe Domain Coordinates for d5ivua_:

Click to download the PDB-style file with coordinates for d5ivua_.
(The format of our PDB-style files is described here.)

Timeline for d5ivua_:

View in 3D
Domains from other chains:
(mouse over for more information)
d5ivub_