Lineage for d5k1va4 (5k1v A:638-960)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2725421Fold a.118: alpha-alpha superhelix [48370] (28 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 2725422Superfamily a.118.1: ARM repeat [48371] (28 families) (S)
  5. 2726072Family a.118.1.0: automated matches [191340] (1 protein)
    not a true family
  6. 2726073Protein automated matches [190220] (14 species)
    not a true protein
  7. 2726099Species Human (Homo sapiens) [TaxId:9606] [189070] (63 PDB entries)
  8. 2726162Domain d5k1va4: 5k1v A:638-960 [332390]
    Other proteins in same PDB: d5k1va1, d5k1va2, d5k1va3, d5k1va5, d5k1vb1, d5k1vb2
    automated match to d3se6a4
    complexed with 6px, nag, zn

Details for d5k1va4

PDB Entry: 5k1v (more details), 2.9 Å

PDB Description: crystal structure of endoplasmic reticulum aminopeptidase 2 (erap2) in complex with a diaminobenzoic acid derivative ligand.
PDB Compounds: (A:) Endoplasmic reticulum aminopeptidase 2

SCOPe Domain Sequences for d5k1va4:

Sequence; same for both SEQRES and ATOM records: (download)

>d5k1va4 a.118.1.0 (A:638-960) automated matches {Human (Homo sapiens) [TaxId: 9606]}
hgwdqlitqlnqnhtllrpkdrvglihdvfqlvgagrltldkaldmtyylqhetsspall
eglsylesfyhmmdrrnisdisenlkryllqyfkpvidrqswsdkgsvwdrmlrsallkl
acdlnhapciqkaaelfsqwmessgklniptdvlkivysvgaqttagwnylleqyelsms
saeqnkilyalstskhqekllklielgmegkviktqnlaallhaiarrpkgqqlawdfvr
enwthllkkfdlgsydirmiisgttahfsskdklqevklffesleaqgshldifqtvlet
itknikwleknlptlrtwlmvnt

SCOPe Domain Coordinates for d5k1va4:

Click to download the PDB-style file with coordinates for d5k1va4.
(The format of our PDB-style files is described here.)

Timeline for d5k1va4: