Class a: All alpha proteins [46456] (290 folds) |
Fold a.118: alpha-alpha superhelix [48370] (28 superfamilies) multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix |
Superfamily a.118.1: ARM repeat [48371] (28 families) |
Family a.118.1.0: automated matches [191340] (1 protein) not a true family |
Protein automated matches [190220] (14 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [189070] (63 PDB entries) |
Domain d5k1va4: 5k1v A:638-960 [332390] Other proteins in same PDB: d5k1va1, d5k1va2, d5k1va3, d5k1va5, d5k1vb1, d5k1vb2 automated match to d3se6a4 complexed with 6px, nag, zn |
PDB Entry: 5k1v (more details), 2.9 Å
SCOPe Domain Sequences for d5k1va4:
Sequence; same for both SEQRES and ATOM records: (download)
>d5k1va4 a.118.1.0 (A:638-960) automated matches {Human (Homo sapiens) [TaxId: 9606]} hgwdqlitqlnqnhtllrpkdrvglihdvfqlvgagrltldkaldmtyylqhetsspall eglsylesfyhmmdrrnisdisenlkryllqyfkpvidrqswsdkgsvwdrmlrsallkl acdlnhapciqkaaelfsqwmessgklniptdvlkivysvgaqttagwnylleqyelsms saeqnkilyalstskhqekllklielgmegkviktqnlaallhaiarrpkgqqlawdfvr enwthllkkfdlgsydirmiisgttahfsskdklqevklffesleaqgshldifqtvlet itknikwleknlptlrtwlmvnt
Timeline for d5k1va4:
View in 3D Domains from same chain: (mouse over for more information) d5k1va1, d5k1va2, d5k1va3, d5k1va5 |