Lineage for d5k1va3 (5k1v A:547-637)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2766973Superfamily b.1.30: Zn aminopeptidase insert domain [254133] (2 families) (S)
    same topology as (b.1.15.1)
  5. 2766995Family b.1.30.0: automated matches [254306] (1 protein)
    not a true family
  6. 2766996Protein automated matches [254707] (4 species)
    not a true protein
  7. 2766997Species Human (Homo sapiens) [TaxId:9606] [255965] (22 PDB entries)
  8. 2767024Domain d5k1va3: 5k1v A:547-637 [332389]
    Other proteins in same PDB: d5k1va1, d5k1va2, d5k1va4, d5k1va5, d5k1vb1, d5k1vb2, d5k1vb3
    automated match to d3se6a3
    complexed with 6px, nag, zn

Details for d5k1va3

PDB Entry: 5k1v (more details), 2.9 Å

PDB Description: crystal structure of endoplasmic reticulum aminopeptidase 2 (erap2) in complex with a diaminobenzoic acid derivative ligand.
PDB Compounds: (A:) Endoplasmic reticulum aminopeptidase 2

SCOPe Domain Sequences for d5k1va3:

Sequence; same for both SEQRES and ATOM records: (download)

>d5k1va3 b.1.30.0 (A:547-637) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ipllvvkqdgcslrlqqerflqgvfqedpewralqerylwhipltystsssnvihrhilk
sktdtldlpektswvkfnvdsngyyivhyeg

SCOPe Domain Coordinates for d5k1va3:

Click to download the PDB-style file with coordinates for d5k1va3.
(The format of our PDB-style files is described here.)

Timeline for d5k1va3: