| Class b: All beta proteins [48724] (180 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.30: Zn aminopeptidase insert domain [254133] (2 families) ![]() same topology as (b.1.15.1) |
| Family b.1.30.0: automated matches [254306] (1 protein) not a true family |
| Protein automated matches [254707] (4 species) not a true protein |
| Species Human (Homo sapiens) [TaxId:9606] [255965] (22 PDB entries) |
| Domain d5k1va3: 5k1v A:547-637 [332389] Other proteins in same PDB: d5k1va1, d5k1va2, d5k1va4, d5k1va5, d5k1vb1, d5k1vb2, d5k1vb3 automated match to d3se6a3 complexed with 6px, nag, zn |
PDB Entry: 5k1v (more details), 2.9 Å
SCOPe Domain Sequences for d5k1va3:
Sequence; same for both SEQRES and ATOM records: (download)
>d5k1va3 b.1.30.0 (A:547-637) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ipllvvkqdgcslrlqqerflqgvfqedpewralqerylwhipltystsssnvihrhilk
sktdtldlpektswvkfnvdsngyyivhyeg
Timeline for d5k1va3:
View in 3DDomains from same chain: (mouse over for more information) d5k1va1, d5k1va2, d5k1va4, d5k1va5 |