Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.21: Diaminopimelate epimerase-like [54505] (1 superfamily) mixed beta-sheet folds into a barrel (n=8, S=14) around the central helix |
Superfamily d.21.1: Diaminopimelate epimerase-like [54506] (5 families) duplication: consists of two similar domain swapped with C-terminal strands |
Family d.21.1.2: PhzC/PhzF-like [89863] (4 proteins) Pfam PF02567 |
Protein Phenazine biosynthesis protein PhzF [117861] (1 species) |
Species Pseudomonas fluorescens [TaxId:294] [117862] (7 PDB entries) Uniprot Q51792 |
Domain d5iwea2: 5iwe A:129-278 [332385] Other proteins in same PDB: d5iwea3 automated match to d1xuba2 complexed with edo, gol, peg, w81; mutant |
PDB Entry: 5iwe (more details), 1.71 Å
SCOPe Domain Sequences for d5iwea2:
Sequence; same for both SEQRES and ATOM records: (download)
>d5iwea2 d.21.1.2 (A:129-278) Phenazine biosynthesis protein PhzF {Pseudomonas fluorescens [TaxId: 294]} rdaellkalgisdstfpieiyhngprhvfvglpsidalsalhpdhralsnfhdmaincfa gagrrwrsrmfspaygvvedaatgsaagplaihlarhgqiefgqpveilqgveigrpslm fakaegraeqltrvevsgngvtfgrgtivl
Timeline for d5iwea2: