Lineage for d5iwea1 (5iwe A:1-128)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2546594Fold d.21: Diaminopimelate epimerase-like [54505] (1 superfamily)
    mixed beta-sheet folds into a barrel (n=8, S=14) around the central helix
  4. 2546595Superfamily d.21.1: Diaminopimelate epimerase-like [54506] (5 families) (S)
    duplication: consists of two similar domain swapped with C-terminal strands
  5. 2546660Family d.21.1.2: PhzC/PhzF-like [89863] (4 proteins)
    Pfam PF02567
  6. 2546689Protein Phenazine biosynthesis protein PhzF [117861] (1 species)
  7. 2546690Species Pseudomonas fluorescens [TaxId:294] [117862] (7 PDB entries)
    Uniprot Q51792
  8. 2546705Domain d5iwea1: 5iwe A:1-128 [332384]
    Other proteins in same PDB: d5iwea3
    automated match to d1u1wa1
    complexed with edo, gol, peg, w81; mutant

Details for d5iwea1

PDB Entry: 5iwe (more details), 1.71 Å

PDB Description: e45q mutant of phenazine biosynthesis protein phzf in complex with (5r,6r)-6-azaniumyl-5-ethoxycyclohexa-1,3-diene-1-carboxylate
PDB Compounds: (A:) Trans-2,3-dihydro-3-hydroxyanthranilate isomerase

SCOPe Domain Sequences for d5iwea1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5iwea1 d.21.1.2 (A:1-128) Phenazine biosynthesis protein PhzF {Pseudomonas fluorescens [TaxId: 294]}
mhnyviidafasvplegnpvavffdaddlppaqmqriaremnlsqstfvlkprnggdali
riftpvnelpfaghpllgtaialgahtdnhrlyletqmgtiafelerqngsviaasmdqp
iptwtalg

SCOPe Domain Coordinates for d5iwea1:

Click to download the PDB-style file with coordinates for d5iwea1.
(The format of our PDB-style files is described here.)

Timeline for d5iwea1: