SCOPe 2.08: Domain d5ioza1: 5ioz A:22-94

Lineage for d5ioza1 (5ioz A:22-94)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.1: Homeodomain-like [46689] (21 families)
   consists only of helices

5. Family a.4.1.9: Tetracyclin repressor-like, N-terminal domain [46764] (35 proteins)

6. Protein Ethr repressor [109651] (2 species)

7. Species Mycobacterium tuberculosis [TaxId:419947] [332339] (4 PDB entries)

8. Domain d5ioza1: 5ioz A:22-94 [332382]
   Other proteins in same PDB: d5ioza2
   automated match to d1t56a1
   complexed with 6c4

Details for d5ioza1

PDB Entry: 5ioz, 2.02 Å

PDB Description: structure of transcriptional regulatory repressor protein - ethr from mycobacterium tuberculosis in complex with n-(cyclopentylmethyl) cyclopentanecarboxamide at 2.02a resolution

PDB Compounds: (A:) TetR-family transcriptional regulatory repressor protein

SCOPe Domain Sequences for d5ioza1:

Sequence; same for both SEQRES and ATOM records:

>d5ioza1 a.4.1.9 (A:22-94) Ethr repressor {Mycobacterium tuberculosis [TaxId: 419947]}
gddrelailataenlledrpladisvddlakgagisrptfyfyfpskeavlltlldrvvn
qadmalqtlaenp

Timeline for d5ioza1:

• d5ioza1 first appeared in SCOPe 2.06
  
• d5ioza1 appears in SCOPe 2.07