Lineage for d5ioza1 (5ioz A:22-94)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2691777Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 2691778Superfamily a.4.1: Homeodomain-like [46689] (21 families) (S)
    consists only of helices
  5. 2692210Family a.4.1.9: Tetracyclin repressor-like, N-terminal domain [46764] (35 proteins)
  6. 2692217Protein Ethr repressor [109651] (2 species)
  7. 2692263Species Mycobacterium tuberculosis [TaxId:419947] [332339] (4 PDB entries)
  8. 2692267Domain d5ioza1: 5ioz A:22-94 [332382]
    Other proteins in same PDB: d5ioza2
    automated match to d1t56a1
    complexed with 6c4

Details for d5ioza1

PDB Entry: 5ioz (more details), 2.02 Å

PDB Description: structure of transcriptional regulatory repressor protein - ethr from mycobacterium tuberculosis in complex with n-(cyclopentylmethyl) cyclopentanecarboxamide at 2.02a resolution
PDB Compounds: (A:) TetR-family transcriptional regulatory repressor protein

SCOPe Domain Sequences for d5ioza1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5ioza1 a.4.1.9 (A:22-94) Ethr repressor {Mycobacterium tuberculosis [TaxId: 419947]}
gddrelailataenlledrpladisvddlakgagisrptfyfyfpskeavlltlldrvvn
qadmalqtlaenp

SCOPe Domain Coordinates for d5ioza1:

Click to download the PDB-style file with coordinates for d5ioza1.
(The format of our PDB-style files is described here.)

Timeline for d5ioza1:

View in 3D
Domains from same chain:
(mouse over for more information)
d5ioza2