Lineage for d5in2a_ (5in2 A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2763708Superfamily b.1.8: Cu,Zn superoxide dismutase-like [49329] (2 families) (S)
    has additional strand at N-terminus
  5. 2764467Family b.1.8.0: automated matches [191527] (1 protein)
    not a true family
  6. 2764468Protein automated matches [190890] (7 species)
    not a true protein
  7. 2764490Species Onchocerca volvulus [TaxId:6282] [332380] (1 PDB entry)
  8. 2764491Domain d5in2a_: 5in2 A: [332381]
    automated match to d3km1a_
    complexed with azi, cl, cu, gol, pge, so4, zn

Details for d5in2a_

PDB Entry: 5in2 (more details), 1.55 Å

PDB Description: crystal structure of extra cellular cu/zn superoxide dismutase from onchocerca volvulus at 1.5 angstrom; insight into novel binding site and new inhibitors
PDB Compounds: (A:) Extracellular superoxide dismutase [Cu-Zn]

SCOPe Domain Sequences for d5in2a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5in2a_ b.1.8.0 (A:) automated matches {Onchocerca volvulus [TaxId: 6282]}
arravavlrgdagvsgiiyfqqgsggsittisgsvsgltpglhgfhvhqygdqtngctsa
gdhynpfgkthggpndrikhigdlgnivagangvaevyinsydiklrgplsvighslvvh
antddlgqgtgnmreeslktgnagsrlacgvigiaa

SCOPe Domain Coordinates for d5in2a_:

Click to download the PDB-style file with coordinates for d5in2a_.
(The format of our PDB-style files is described here.)

Timeline for d5in2a_: