![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.8: Cu,Zn superoxide dismutase-like [49329] (2 families) ![]() has additional strand at N-terminus |
![]() | Family b.1.8.0: automated matches [191527] (1 protein) not a true family |
![]() | Protein automated matches [190890] (7 species) not a true protein |
![]() | Species Onchocerca volvulus [TaxId:6282] [332380] (1 PDB entry) |
![]() | Domain d5in2a_: 5in2 A: [332381] automated match to d3km1a_ complexed with azi, cl, cu, gol, pge, so4, zn |
PDB Entry: 5in2 (more details), 1.55 Å
SCOPe Domain Sequences for d5in2a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5in2a_ b.1.8.0 (A:) automated matches {Onchocerca volvulus [TaxId: 6282]} arravavlrgdagvsgiiyfqqgsggsittisgsvsgltpglhgfhvhqygdqtngctsa gdhynpfgkthggpndrikhigdlgnivagangvaevyinsydiklrgplsvighslvvh antddlgqgtgnmreeslktgnagsrlacgvigiaa
Timeline for d5in2a_: