| Class a: All alpha proteins [46456] (289 folds) |
| Fold a.139: Type I dockerin domain [63445] (1 superfamily) tandem repeat of two calcium-binding loop-helix motifs, distinct from the EF-hand |
Superfamily a.139.1: Type I dockerin domain [63446] (2 families) ![]() |
| Family a.139.1.0: automated matches [191542] (1 protein) not a true family |
| Protein automated matches [190928] (7 species) not a true protein |
| Species Clostridium thermocellum [TaxId:1249482] [332378] (1 PDB entry) |
| Domain d5k39b2: 5k39 B:103-159 [332379] Other proteins in same PDB: d5k39a1, d5k39a2, d5k39a3, d5k39b1 automated match to d4u3sb2 complexed with ca |
PDB Entry: 5k39 (more details), 1.98 Å
SCOPe Domain Sequences for d5k39b2:
Sequence; same for both SEQRES and ATOM records: (download)
>d5k39b2 a.139.1.0 (B:103-159) automated matches {Clostridium thermocellum [TaxId: 1249482]}
erkgvqdnainmvdvmeiskvfgtragdeeyvaeldlnmdgainlfdiaivirhfna
Timeline for d5k39b2: