| Class b: All beta proteins [48724] (180 folds) |
| Fold b.3: Prealbumin-like [49451] (8 superfamilies) sandwich; 7 strands in 2 sheets, greek-key variations: some members have additional 1-2 strands to common fold |
Superfamily b.3.2: Carboxypeptidase regulatory domain-like [49464] (3 families) ![]() |
| Family b.3.2.0: automated matches [275446] (1 protein) not a true family |
| Protein automated matches [275447] (3 species) not a true protein |
| Species Clostridium thermocellum [TaxId:1249482] [332376] (1 PDB entry) |
| Domain d5k39b1: 5k39 B:7-102 [332377] Other proteins in same PDB: d5k39a1, d5k39a2, d5k39a3, d5k39b2 automated match to d4u3sb1 complexed with ca |
PDB Entry: 5k39 (more details), 1.98 Å
SCOPe Domain Sequences for d5k39b1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5k39b1 b.3.2.0 (B:7-102) automated matches {Clostridium thermocellum [TaxId: 1249482]}
dkttvsgyisvdfdyppeseskiksgfnvkvagtelstktdekgyfeisgipgdmreftl
eiskrnylkrnvtvngtgklvvstednplilwagdv
Timeline for d5k39b1: