SCOPe 2.08: Domain d5k39b1: 5k39 B:7-102

Lineage for d5k39b1 (5k39 B:7-102)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.3: Prealbumin-like [49451] (8 superfamilies)
   sandwich; 7 strands in 2 sheets, greek-key
   variations: some members have additional 1-2 strands to common fold

4. Superfamily b.3.2: Carboxypeptidase regulatory domain-like [49464] (3 families)

5. Family b.3.2.0: automated matches [275446] (1 protein)
   not a true family

6. Protein automated matches [275447] (3 species)
   not a true protein

7. Species Clostridium thermocellum [TaxId:1249482] [332376] (1 PDB entry)

8. Domain d5k39b1: 5k39 B:7-102 [332377]
   Other proteins in same PDB: d5k39a1, d5k39a2, d5k39a3, d5k39b2
   automated match to d4u3sb1
   complexed with ca

Details for d5k39b1

PDB Entry: 5k39, 1.98 Å

PDB Description: the type ii cohesin dockerin complex from clostridium thermocellum

PDB Compounds: (B:) Dockerin module from a protein of unknown function

SCOPe Domain Sequences for d5k39b1:

Sequence; same for both SEQRES and ATOM records:

>d5k39b1 b.3.2.0 (B:7-102) automated matches {Clostridium thermocellum [TaxId: 1249482]}
dkttvsgyisvdfdyppeseskiksgfnvkvagtelstktdekgyfeisgipgdmreftl
eiskrnylkrnvtvngtgklvvstednplilwagdv

Timeline for d5k39b1:

• d5k39b1 first appeared in SCOPe 2.06
  
• d5k39b1 appears in SCOPe 2.07