Lineage for d5ihna_ (5ihn A:)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2053585Fold b.34: SH3-like barrel [50036] (21 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 2053714Superfamily b.34.2: SH3-domain [50044] (2 families) (S)
  5. 2053715Family b.34.2.1: SH3-domain [50045] (40 proteins)
  6. 2053739Protein alpha-Spectrin, SH3 domain [50058] (1 species)
  7. 2053740Species Chicken (Gallus gallus) [TaxId:9031] [50059] (38 PDB entries)
  8. 2053754Domain d5ihna_: 5ihn A: [332375]
    automated match to d2f2va_
    complexed with fmt, na; mutant

Details for d5ihna_

PDB Entry: 5ihn (more details), 1.5 Å

PDB Description: crystal structure of the alpha spectrin sh3 domain mutant n47g
PDB Compounds: (A:) spectrin alpha chain, non-erythrocytic 1

SCOPe Domain Sequences for d5ihna_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5ihna_ b.34.2.1 (A:) alpha-Spectrin, SH3 domain {Chicken (Gallus gallus) [TaxId: 9031]}
kelvlalydyqeksprevtmkkgdiltllnstnkdwwkvevgdrqgfvpaayvkkl

SCOPe Domain Coordinates for d5ihna_:

Click to download the PDB-style file with coordinates for d5ihna_.
(The format of our PDB-style files is described here.)

Timeline for d5ihna_: