Lineage for d5ip6a2 (5ip6 A:95-214)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2727850Fold a.121: Tetracyclin repressor-like, C-terminal domain [48497] (1 superfamily)
    multihelical; interlocked (homo)dimer
  4. 2727851Superfamily a.121.1: Tetracyclin repressor-like, C-terminal domain [48498] (2 families) (S)
  5. 2727852Family a.121.1.1: Tetracyclin repressor-like, C-terminal domain [48499] (35 proteins)
  6. 2727859Protein Ethr repressor [109978] (2 species)
  7. 2727937Species Mycobacterium tuberculosis [TaxId:419947] [332341] (4 PDB entries)
  8. 2727940Domain d5ip6a2: 5ip6 A:95-214 [332369]
    Other proteins in same PDB: d5ip6a1
    automated match to d1t56a2
    complexed with 6c9

Details for d5ip6a2

PDB Entry: 5ip6 (more details), 1.93 Å

PDB Description: structure of transcriptional regulatory repressor protein - ethr from mycobacterium tuberculosis in complex with n-((tetrahydrofuran-3-yl) methyl)pyrrolidine-1-carboxamide at 1.93a resolution
PDB Compounds: (A:) TetR-family transcriptional regulatory repressor protein

SCOPe Domain Sequences for d5ip6a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5ip6a2 a.121.1.1 (A:95-214) Ethr repressor {Mycobacterium tuberculosis [TaxId: 419947]}
adtdrenmwrtginvffetfgshkavtragqaaratsvevaelwstfmqkwiaytaavid
aerdrgaaprtlpahelatalnlmnertlfasfageqpsvpearvldtlvhiwvtsiyge

SCOPe Domain Coordinates for d5ip6a2:

Click to download the PDB-style file with coordinates for d5ip6a2.
(The format of our PDB-style files is described here.)

Timeline for d5ip6a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d5ip6a1