| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.121: Tetracyclin repressor-like, C-terminal domain [48497] (1 superfamily) multihelical; interlocked (homo)dimer |
Superfamily a.121.1: Tetracyclin repressor-like, C-terminal domain [48498] (2 families) ![]() |
| Family a.121.1.1: Tetracyclin repressor-like, C-terminal domain [48499] (35 proteins) |
| Protein Ethr repressor [109978] (2 species) |
| Species Mycobacterium tuberculosis [TaxId:419947] [332341] (4 PDB entries) |
| Domain d5ip6a2: 5ip6 A:95-214 [332369] Other proteins in same PDB: d5ip6a1 automated match to d1t56a2 complexed with 6c9 |
PDB Entry: 5ip6 (more details), 1.93 Å
SCOPe Domain Sequences for d5ip6a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d5ip6a2 a.121.1.1 (A:95-214) Ethr repressor {Mycobacterium tuberculosis [TaxId: 419947]}
adtdrenmwrtginvffetfgshkavtragqaaratsvevaelwstfmqkwiaytaavid
aerdrgaaprtlpahelatalnlmnertlfasfageqpsvpearvldtlvhiwvtsiyge
Timeline for d5ip6a2: