Lineage for d5ip6a1 (5ip6 A:22-94)
- Root: SCOPe 2.07
Class a: All alpha proteins [46456] (289 folds) 
Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
Superfamily a.4.1: Homeodomain-like [46689] (20 families) 
consists only of helices
Family a.4.1.9: Tetracyclin repressor-like, N-terminal domain [46764] (35 proteins) 
Protein Ethr repressor [109651] (2 species) 
Species Mycobacterium tuberculosis [TaxId:419947] [332339] (4 PDB entries) 
Domain d5ip6a1: 5ip6 A:22-94 [332368]
Other proteins in same PDB: d5ip6a2
automated match to d1t56a1
complexed with 6c9
Details for d5ip6a1
PDB Entry: 5ip6 (more details), 1.93 Å
PDB Description: structure of transcriptional regulatory repressor protein - ethr from mycobacterium tuberculosis in complex with n-((tetrahydrofuran-3-yl) methyl)pyrrolidine-1-carboxamide at 1.93a resolution
PDB Compounds: (A:) TetR-family transcriptional regulatory repressor proteinSCOPe Domain Sequences for d5ip6a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5ip6a1 a.4.1.9 (A:22-94) Ethr repressor {Mycobacterium tuberculosis [TaxId: 419947]}
gddrelailataenlledrpladisvddlakgagisrptfyfyfpskeavlltlldrvvn
qadmalqtlaenp
SCOPe Domain Coordinates for d5ip6a1:
Click to download the PDB-style file with coordinates for d5ip6a1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d5ip6a1:
- d5ip6a1 first appeared in SCOPe 2.06
View in 3D
