![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies) core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest |
![]() | Superfamily d.79.5: IpsF-like [69765] (2 families) ![]() forms trimers with three closely packed beta-sheets; possible link between the YjgF-like (d.79.1) and 4'-phosphopantetheinyl transferase superfamilies (d.150.1) |
![]() | Family d.79.5.1: IpsF-like [69766] (3 proteins) automatically mapped to Pfam PF02542 |
![]() | Protein automated matches [190985] (6 species) not a true protein |
![]() | Species Bacillus subtilis [TaxId:224308] [332335] (2 PDB entries) |
![]() | Domain d5iwya_: 5iwy A: [332367] automated match to d1t0aa_ complexed with c5p, mg |
PDB Entry: 5iwy (more details), 1.99 Å
SCOPe Domain Sequences for d5iwya_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5iwya_ d.79.5.1 (A:) automated matches {Bacillus subtilis [TaxId: 224308]} mfrigqgfdvhqlvegrpliiggieipyekgllghsdadvllhtvadaclgavgegdigk hfpdtdpefkdadsfkllqhvwgivkqkgyvlgnidctiiaqkpkmlpyiedmrkriaeg leadvsqvnvkattteklgftgraegiaaqatvliqkg
Timeline for d5iwya_: