![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.121: Tetracyclin repressor-like, C-terminal domain [48497] (1 superfamily) multihelical; interlocked (homo)dimer |
![]() | Superfamily a.121.1: Tetracyclin repressor-like, C-terminal domain [48498] (2 families) ![]() |
![]() | Family a.121.1.1: Tetracyclin repressor-like, C-terminal domain [48499] (35 proteins) |
![]() | Protein Ethr repressor [109978] (2 species) |
![]() | Species Mycobacterium tuberculosis [TaxId:1773] [109979] (65 PDB entries) Uniprot P96222 22-215 |
![]() | Domain d5j1ra2: 5j1r A:95-214 [332347] Other proteins in same PDB: d5j1ra1 automated match to d1t56a2 complexed with 6fg |
PDB Entry: 5j1r (more details), 1.92 Å
SCOPe Domain Sequences for d5j1ra2:
Sequence; same for both SEQRES and ATOM records: (download)
>d5j1ra2 a.121.1.1 (A:95-214) Ethr repressor {Mycobacterium tuberculosis [TaxId: 1773]} adtdrenmwrtginvffetfgshkavtragqaaratsvevaelwstfmqkwiaytaavid aerdrgaaprtlpahelatalnlmnertlfasfageqpsvpearvldtlvhiwvtsiyge
Timeline for d5j1ra2: