| Class a: All alpha proteins [46456] (289 folds) |
| Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
Superfamily a.4.1: Homeodomain-like [46689] (20 families) ![]() consists only of helices |
| Family a.4.1.9: Tetracyclin repressor-like, N-terminal domain [46764] (35 proteins) |
| Protein Ethr repressor [109651] (2 species) |
| Species Mycobacterium tuberculosis [TaxId:1773] [109652] (28 PDB entries) Uniprot P96222 22-215 |
| Domain d5j1ra1: 5j1r A:22-94 [332346] Other proteins in same PDB: d5j1ra2 automated match to d1t56a1 complexed with 6fg |
PDB Entry: 5j1r (more details), 1.92 Å
SCOPe Domain Sequences for d5j1ra1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5j1ra1 a.4.1.9 (A:22-94) Ethr repressor {Mycobacterium tuberculosis [TaxId: 1773]}
gddrelailataenlledrpladisvddlakgagisrptfyfyfpskeavlltlldrvvn
qadmalqtlaenp
Timeline for d5j1ra1: