SCOPe 2.08: Domain d5j1ra1: 5j1r A:22-94

Lineage for d5j1ra1 (5j1r A:22-94)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.1: Homeodomain-like [46689] (21 families)
   consists only of helices

5. Family a.4.1.9: Tetracyclin repressor-like, N-terminal domain [46764] (35 proteins)

6. Protein Ethr repressor [109651] (2 species)

7. Species Mycobacterium tuberculosis [TaxId:1773] [109652] (34 PDB entries)
   Uniprot P96222 22-215

8. Domain d5j1ra1: 5j1r A:22-94 [332346]
   Other proteins in same PDB: d5j1ra2
   automated match to d1t56a1
   complexed with 6fg

Details for d5j1ra1

PDB Entry: 5j1r, 1.92 Å

PDB Description: structure of transcriptional regulatory repressor protein - ethr from mycobacterium tuberculosis in complex with 3-(furan-3-yl)-1- (pyrrolidin-1-yl)propan-1-one at 1.92a resolution

PDB Compounds: (A:) EthR

SCOPe Domain Sequences for d5j1ra1:

Sequence; same for both SEQRES and ATOM records:

>d5j1ra1 a.4.1.9 (A:22-94) Ethr repressor {Mycobacterium tuberculosis [TaxId: 1773]}
gddrelailataenlledrpladisvddlakgagisrptfyfyfpskeavlltlldrvvn
qadmalqtlaenp

Timeline for d5j1ra1:

• d5j1ra1 first appeared in SCOPe 2.06
  
• d5j1ra1 appears in SCOPe 2.07