Lineage for d1qpsa_ (1qps A:)

  1. Root: SCOP 1.71
  2. 570216Class c: Alpha and beta proteins (a/b) [51349] (134 folds)
  3. 585880Fold c.52: Restriction endonuclease-like [52979] (3 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 5 strands, order 12345; strands 2 &, in some families, 5 are antiparallel to the rest
  4. 585881Superfamily c.52.1: Restriction endonuclease-like [52980] (30 families) (S)
  5. 585882Family c.52.1.1: Restriction endonuclease EcoRI [52981] (1 protein)
  6. 585883Protein Restriction endonuclease EcoRI [52982] (1 species)
  7. 585884Species Escherichia coli [TaxId:562] [52983] (7 PDB entries)
  8. 585890Domain d1qpsa_: 1qps A: [33234]
    complexed with mn

Details for d1qpsa_

PDB Entry: 1qps (more details), 2.5 Å

PDB Description: the crystal structure of a post-reactive cognate dna-eco ri complex at 2.50 a in the presence of mn2+ ion

SCOP Domain Sequences for d1qpsa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qpsa_ c.52.1.1 (A:) Restriction endonuclease EcoRI {Escherichia coli}
sqgvigifgdyakahdlavgevsklvkkalsneypqlsfryrdsikkteinealkkidpd
lggtlfvsnssikpdggivevkddygewrvvlvaeakhqgkdiinirngllvgkrgdqdl
maagnaiershkniseianfmlseshfpyvlflegsnfltenisitrpdgrvvnleynsg
ilnrldrltaanygmpinsnlcinkfvnhkdksimlqaasiytqgdgrewdskimfeimf
disttslrvlgrdlfeqltsk

SCOP Domain Coordinates for d1qpsa_:

Click to download the PDB-style file with coordinates for d1qpsa_.
(The format of our PDB-style files is described here.)

Timeline for d1qpsa_: