Lineage for d1qria_ (1qri A:)

  1. Root: SCOP 1.71
  2. 570216Class c: Alpha and beta proteins (a/b) [51349] (134 folds)
  3. 585880Fold c.52: Restriction endonuclease-like [52979] (3 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 5 strands, order 12345; strands 2 &, in some families, 5 are antiparallel to the rest
  4. 585881Superfamily c.52.1: Restriction endonuclease-like [52980] (30 families) (S)
  5. 585882Family c.52.1.1: Restriction endonuclease EcoRI [52981] (1 protein)
  6. 585883Protein Restriction endonuclease EcoRI [52982] (1 species)
  7. 585884Species Escherichia coli [TaxId:562] [52983] (7 PDB entries)
  8. 585888Domain d1qria_: 1qri A: [33233]
    protein/DNA complex; mutant

Details for d1qria_

PDB Entry: 1qri (more details), 2.6 Å

PDB Description: x-ray structure of the dna-eco ri endonuclease complexes with an e144d mutation at 2.7 a

SCOP Domain Sequences for d1qria_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qria_ c.52.1.1 (A:) Restriction endonuclease EcoRI {Escherichia coli}
sqgvigifgdyakahdlavgevsklvkkalsneypqlsfryrdsikkteinealkkidpd
lggtlfvsnssikpdggivevkddygewrvvlvaeakhqgkdiinirngllvgkrgdqdl
maagnaidrshkniseianfmlseshfpyvlflegsnfltenisitrpdgrvvnleynsg
ilnrldrltaanygmpinsnlcinkfvnhkdksimlqaasiytqgdgrewdskimfeimf
disttslrvlgrdlfeqltsk

SCOP Domain Coordinates for d1qria_:

Click to download the PDB-style file with coordinates for d1qria_.
(The format of our PDB-style files is described here.)

Timeline for d1qria_: