Class a: All alpha proteins [46456] (289 folds) |
Fold a.25: Ferritin-like [47239] (6 superfamilies) core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection |
Superfamily a.25.1: Ferritin-like [47240] (10 families) contains bimetal-ion centre in the middle of the bundle |
Family a.25.1.1: Ferritin [47241] (10 proteins) |
Protein (Apo)ferritin [47246] (8 species) |
Species Horse (Equus caballus), L chain [TaxId:9796] [47248] (81 PDB entries) |
Domain d5gu2x_: 5gu2 X: [332329] automated match to d3nozx_ complexed with au, cd, edo, so4 |
PDB Entry: 5gu2 (more details), 2.12 Å
SCOPe Domain Sequences for d5gu2x_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5gu2x_ a.25.1.1 (X:) (Apo)ferritin {Horse (Equus caballus), L chain [TaxId: 9796]} qirqnysteveaavnrlvnlylrasytylslgfyfdrddvalcgvchffcelaeekrega erllkmqnqrggralfqdlqkpsqdewgttldamkaaivlekslnqalldlhalgsaqad phlcdfleshfldeevklikkmgdhltniqrlvgsqaglgeylferltl
Timeline for d5gu2x_: