Lineage for d5gu0x_ (5gu0 X:)

  1. Root: SCOPe 2.08
  2. Class a: All alpha proteins [46456] (290 folds)
  3. Fold a.25: Ferritin-like [47239] (6 superfamilies)
    core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection
  4. Superfamily a.25.1: Ferritin-like [47240] (10 families) (S)
    contains bimetal-ion centre in the middle of the bundle
  5. Family a.25.1.1: Ferritin [47241] (10 proteins)
  6. Protein (Apo)ferritin [47246] (8 species)
  7. Species Horse (Equus caballus), L chain [TaxId:9796] [47248] (81 PDB entries)
  8. Domain d5gu0x_: 5gu0 X: [332328]
    automated match to d3nozx_
    complexed with au, cd, edo, so4

Details for d5gu0x_

PDB Entry: 5gu0 (more details), 1.95 Å

PDB Description: crystal structure of au.cl-apo-e45c/r52c-rhlfr
PDB Compounds: (X:) ferritin light chain

SCOPe Domain Sequences for d5gu0x_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5gu0x_ a.25.1.1 (X:) (Apo)ferritin {Horse (Equus caballus), L chain [TaxId: 9796]}
qirqnysteveaavnrlvnlylrasytylslgfyfdrddvalcgvchffcelaeekrega
erllkmqnqrggralfqdlqkpsqdewgttldamkaaivlekslnqalldlhalgsaqad
phlcdfleshfldeevklikkmgdhltniqrlvgsqaglgeylferltlk

SCOPe Domain Coordinates for d5gu0x_ are not available.

Timeline for d5gu0x_: