SCOPe 2.08: Domain d5flka1: 5flk A:4-293

Lineage for d5flka1 (5flk A:4-293)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
   core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest

4. Superfamily c.69.1: alpha/beta-Hydrolases [53474] (43 families)
   many members have left-handed crossover connection between strand 8 and additional strand 9

5. Family c.69.1.8: Haloalkane dehalogenase [53513] (2 proteins)

6. Protein automated matches [190880] (5 species)
   not a true protein

7. Species Rhodococcus rhodochrous [TaxId:1829] [189127] (16 PDB entries)

8. Domain d5flka1: 5flk A:4-293 [332326]
   Other proteins in same PDB: d5flka2
   automated match to d2v9za_
   complexed with mes, peg

Details for d5flka1

PDB Entry: 5flk, 0.99 Å

PDB Description: structure of haloalkane dehalogenase variant dhaa101

PDB Compounds: (A:) dhaa101

SCOPe Domain Sequences for d5flka1:

Sequence; same for both SEQRES and ATOM records:

>d5flka1 c.69.1.8 (A:4-293) automated matches {Rhodococcus rhodochrous [TaxId: 1829]}
igtgfpfdphyvevlgsrmhyvdvgprdgtpvlflhgnptssylwrniiphvapshrcia
pdligmgksdkpdldyrfddhvryldafiealgleevvlvihdwgsalgfhwakrnperv
kgiacmefirpiptwdewpefaretfqafrtpdvgreliidqnafiegalpkcvvrplte
vemdhyrepflkpvdreplwrfpnelpiagepanivalveaymnwlhqspvpkllfwgtp
gvlippaeaarlaeslpncktvdigpglhylqednpdligseiarwlpal

Timeline for d5flka1:

• d5flka1 first appeared in SCOPe 2.06
  
• d5flka1 appears in SCOPe 2.07