Lineage for d5lx9h1 (5lx9 H:1-121)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2754035Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2754036Protein automated matches [190740] (31 species)
    not a true protein
  7. 2759478Species Mouse (Mus musculus) [TaxId:10090] [188198] (836 PDB entries)
  8. 2760666Domain d5lx9h1: 5lx9 H:1-121 [332324]
    automated match to d4f9lc2
    complexed with ola, olb, zn

Details for d5lx9h1

PDB Entry: 5lx9 (more details), 2.4 Å

PDB Description: crystal structure of human adiponectin receptor 2 in complex with a c18 free fatty acid at 2.4 angstrom resolution
PDB Compounds: (H:) single-chain variable fragment

SCOPe Domain Sequences for d5lx9h1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5lx9h1 b.1.1.0 (H:1-121) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
evllqqsgpelvkpgasvritckasgytftdfnmdwvkqspgkslewigdfnpnsggsiy
nqkfkdkatftvdkssstaymelrsltfedtavyycaretgtawfaywgqgtlvtvsaag
g

SCOPe Domain Coordinates for d5lx9h1:

Click to download the PDB-style file with coordinates for d5lx9h1.
(The format of our PDB-style files is described here.)

Timeline for d5lx9h1: