SCOPe 2.08: Domain d5m8da2: 5m8d A:246-438

Lineage for d5m8da2 (5m8d A:246-438)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies)
   core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest

4. Superfamily d.79.2: Tubulin C-terminal domain-like [55307] (2 families)

5. Family d.79.2.1: Tubulin, C-terminal domain [55308] (4 proteins)

6. Protein automated matches [227071] (7 species)
   not a true protein

7. Species Cow (Bos taurus) [TaxId:9913] [226565] (136 PDB entries)

8. Domain d5m8da2: 5m8d A:246-438 [332322]
   Other proteins in same PDB: d5m8da1, d5m8db1, d5m8dc1, d5m8dd1, d5m8de_, d5m8df1, d5m8df2, d5m8df3
   automated match to d4i50a2
   complexed with acp, ca, gdp, gol, gtp, mes, mg, ugi

Details for d5m8da2

PDB Entry: 5m8d, 2.25 Å

PDB Description: tubulin mtd265-r1 complex

PDB Compounds: (A:) Tubulin alpha-1B chain

SCOPe Domain Sequences for d5m8da2:

Sequence; same for both SEQRES and ATOM records:

>d5m8da2 d.79.2.1 (A:246-438) automated matches {Cow (Bos taurus) [TaxId: 9913]}
galnvdltefqtnlvpyprihfplatyapvisaekayheqlsvaeitnacfepanqmvkc
dprhgkymaccllyrgdvvpkdvnaaiatiktkrsiqfvdwcptgfkvginyqpptvvpg
gdlakvqravcmlsnttaiaeawarldhkfdlmyakrafvhwyvgegmeegefsearedm
aalekdyeevgvd

Timeline for d5m8da2:

• d5m8da2 first appeared in SCOPe 2.06
  
• d5m8da2 appears in SCOPe 2.07