SCOPe 2.07: Domain d5b3sn1: 5b3s N:2-514

Lineage for d5b3sn1 (5b3s N:2-514)

1. Root: SCOPe 2.07

2. Class f: Membrane and cell surface proteins and peptides [56835] (60 folds)

3. Fold f.24: Cytochrome c oxidase subunit I-like [81443] (1 superfamily)
   12 transmembrane helices in an approximate threefold rotational symmetric arrangement

4. Superfamily f.24.1: Cytochrome c oxidase subunit I-like [81442] (1 family)

5. Family f.24.1.1: Cytochrome c oxidase subunit I-like [81441] (5 proteins)
   the largest and best conserved subunit, contains two heme groups, low spin heme a and high spin heme a3

6. Protein Mitochondrial cytochrome c oxidase, subunit I [81433] (1 species)

7. Species Cow (Bos taurus) [TaxId:9913] [81432] (35 PDB entries)

8. Domain d5b3sn1: 5b3s N:2-514 [332306]
   Other proteins in same PDB: d5b3sa2, d5b3sb1, d5b3sb2, d5b3sb3, d5b3sc_, d5b3sd_, d5b3se_, d5b3sf_, d5b3sg_, d5b3sh_, d5b3si1, d5b3si2, d5b3sj_, d5b3sk_, d5b3sl_, d5b3sm_, d5b3sn2, d5b3so1, d5b3so2, d5b3so3, d5b3sp_, d5b3sq_, d5b3sr_, d5b3ss_, d5b3st_, d5b3su_, d5b3sv1, d5b3sv2, d5b3sw_, d5b3sx_, d5b3sy_, d5b3sz_
   automated match to d1v54a_
   complexed with cdl, chd, cmo, cu, cua, dmu, edo, hea, mg, na, pek, pgv, psc, tgl, zn

Details for d5b3sn1

PDB Entry: 5b3s, 1.68 Å

PDB Description: bovine heart cytochrome c oxidase in the carbon monoxide-bound mixed- valence state at 1.68 angstrom resolution (50 k)

PDB Compounds: (N:) Cytochrome c oxidase subunit 1

SCOPe Domain Sequences for d5b3sn1:

Sequence; same for both SEQRES and ATOM records:

>d5b3sn1 f.24.1.1 (N:2-514) Mitochondrial cytochrome c oxidase, subunit I {Cow (Bos taurus) [TaxId: 9913]}
finrwlfstnhkdigtlyllfgawagmvgtalslliraelgqpgtllgddqiynvvvtah
afvmiffmvmpimiggfgnwlvplmigapdmafprmnnmsfwllppsfllllassmveag
agtgwtvypplagnlahagasvdltifslhlagvssilgainfittiinmkppamsqyqt
plfvwsvmitavllllslpvlaagitmlltdrnlnttffdpagggdpilyqhlfwffghp
evyililpgfgmishivtyysgkkepfgymgmvwammsigflgfivwahhmftvgmdvdt
rayftsatmiiaiptgvkvfswlatlhggnikwspammwalgfiflftvggltgivlans
sldivlhdtyyvvahfhyvlsmgavfaimggfvhwfplfsgytlndtwakihfaimfvgv
nmtffpqhflglsgmprrysdypdaytmwntissmgsfisltavmlmvfiiweafaskre
vltvdltttnlewlngcpppyhtfeeptyvnlk

Timeline for d5b3sn1:

• d5b3sn1 first appeared in SCOPe 2.06
  
• d5b3sn1 appears in the current release, SCOPe 2.08