Class f: Membrane and cell surface proteins and peptides [56835] (69 folds) |
Fold f.24: Cytochrome c oxidase subunit I-like [81443] (1 superfamily) 12 transmembrane helices in an approximate threefold rotational symmetric arrangement |
Superfamily f.24.1: Cytochrome c oxidase subunit I-like [81442] (1 family) |
Family f.24.1.1: Cytochrome c oxidase subunit I-like [81441] (5 proteins) the largest and best conserved subunit, contains two heme groups, low spin heme a and high spin heme a3 |
Protein Mitochondrial cytochrome c oxidase, subunit I [81433] (1 species) |
Species Cow (Bos taurus) [TaxId:9913] [81432] (40 PDB entries) |
Domain d5b3sn1: 5b3s N:2-514 [332306] Other proteins in same PDB: d5b3sa2, d5b3sb1, d5b3sb2, d5b3sb3, d5b3sc_, d5b3sd_, d5b3se_, d5b3sf_, d5b3sg_, d5b3sh_, d5b3si1, d5b3si2, d5b3sj_, d5b3sk_, d5b3sl_, d5b3sm_, d5b3sn2, d5b3so1, d5b3so2, d5b3so3, d5b3sp_, d5b3sq_, d5b3sr_, d5b3ss_, d5b3st_, d5b3su_, d5b3sv1, d5b3sv2, d5b3sw_, d5b3sx_, d5b3sy_, d5b3sz_ automated match to d1v54a_ complexed with cdl, chd, cmo, cu, cua, dmu, edo, hea, mg, na, pek, pgv, psc, tgl, zn |
PDB Entry: 5b3s (more details), 1.68 Å
SCOPe Domain Sequences for d5b3sn1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5b3sn1 f.24.1.1 (N:2-514) Mitochondrial cytochrome c oxidase, subunit I {Cow (Bos taurus) [TaxId: 9913]} finrwlfstnhkdigtlyllfgawagmvgtalslliraelgqpgtllgddqiynvvvtah afvmiffmvmpimiggfgnwlvplmigapdmafprmnnmsfwllppsfllllassmveag agtgwtvypplagnlahagasvdltifslhlagvssilgainfittiinmkppamsqyqt plfvwsvmitavllllslpvlaagitmlltdrnlnttffdpagggdpilyqhlfwffghp evyililpgfgmishivtyysgkkepfgymgmvwammsigflgfivwahhmftvgmdvdt rayftsatmiiaiptgvkvfswlatlhggnikwspammwalgfiflftvggltgivlans sldivlhdtyyvvahfhyvlsmgavfaimggfvhwfplfsgytlndtwakihfaimfvgv nmtffpqhflglsgmprrysdypdaytmwntissmgsfisltavmlmvfiiweafaskre vltvdltttnlewlngcpppyhtfeeptyvnlk
Timeline for d5b3sn1:
View in 3D Domains from other chains: (mouse over for more information) d5b3sa1, d5b3sa2, d5b3sb1, d5b3sb2, d5b3sb3, d5b3sc_, d5b3sd_, d5b3se_, d5b3sf_, d5b3sg_, d5b3sh_, d5b3si1, d5b3si2, d5b3sj_, d5b3sk_, d5b3sl_, d5b3sm_, d5b3so1, d5b3so2, d5b3so3, d5b3sp_, d5b3sq_, d5b3sr_, d5b3ss_, d5b3st_, d5b3su_, d5b3sv1, d5b3sv2, d5b3sw_, d5b3sx_, d5b3sy_, d5b3sz_ |